General Information

  • ID:  hor002372
  • Uniprot ID:  Q8WMJ7
  • Protein name:  Neurexophilin-4
  • Gene name:  NXPH4
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  Neurexophilin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPYKVICIFVSFLSFDYKLVQKVCPDYNFQSEHPYFG
  • Length:  77(1-77)
  • Propeptide:  NCHVEYEKTNRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPYKVICIFVSFLSFDYKLVQKVCPDYNFQSEHPYFG
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8WMJ7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8WMJ7-F1.pdbhor002372_AF2.pdbhor002372_ESM.pdb

Physical Information

Mass: 1051122 Formula: C416H611N109O114S6
Absent amino acids: M Common amino acids: CFKVYPQS
pI: 8.12 Basic residues: 13
Polar residues: 24 Hydrophobic residues: 23
Hydrophobicity: -48.05 Boman Index: -13344
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 58.18
Instability Index: 3503.51 Extinction Coefficient cystines: 14815
Absorbance 280nm: 194.93

Literature

  • PubMed ID:  NA
  • Title:  NA